Research peptides
Tesamorelin
Available documentary data and items still to verify are detailed below.
Price incl. VAT€65.00
AvailabilityAvailable
SKUTESAMORELIN
Loading availability…
02 — Information to verify
Product details
Overview
Tesamorelin is a synthetic peptide analogue of GHRH, growth-hormone-releasing hormone. Research examines its interaction with the GHRH receptor and signalling along the GH/IGF-1 axis.
Structure and technical data
Technical data
Format: 10 mg. The molecular record describes a 44-residue peptide with an N-terminal trans-3-hexenoyl group. The one-letter sequence alone does not represent this modification.
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Molecular formula
- C221H366N72O67S
- Reported molecular mass
- 5136 g/mol
- CAS number
- 218949-48-5
- PubChem CID
- 16137828
- Reported synonyms
- Egrifta
Reference molecular data.
Research context
The cited papers analyse transcriptomic and proteomic responses in studies of experimental tesamorelin formulations. They describe metabolic and immune pathways in specific study populations.
The GHRH–GH–IGF-1 axisVisceral, subcutaneous, and liver fatHepatic transcriptome and oxidative phosphorylationVEGFA, TGFB1, and CSF1Immune responses and exploratory areas
The GHRH–GH–IGF-1 axis
Tesamorelin is studied as an analogue of the hypothalamic GHRH signal targeting the pituitary receptor. Responses include GH release and changes in the IGF-1 axis. Stimulating a regulated pathway differs from adding GH directly; peptide structure and endocrine context influence comparisons.
Visceral, subcutaneous, and liver fat
The cited studies concern people with HIV and defined changes in fat distribution. Visceral adipose volume, subcutaneous fat, and liver-fat fraction are separate measurements. Analyses also include radiological tissue density, which differs from the amount of fat lost.
10.1093/cid/cis251 10.1097/QAD.0000000000002897 10.1017/cts.2022.515
Hepatic transcriptome and oxidative phosphorylation
The JCI Insight paper examines liver gene sets across metabolic, inflammatory, and remodelling pathways. It reports enrichment of oxidative-phosphorylation signals and reductions in groups related to inflammation and cell division. A transcriptomic score is not equivalent to an individual clinical outcome.
VEGFA, TGFB1, and CSF1
The targeted proteomic study compares nine plasma proteins connected with pathways identified by gene analysis. The authors report lower VEGFA, TGFB1, and CSF1 versus placebo and correlations with liver-activity or fibrosis scores. Correlation between markers alone does not establish which step causes the outcome.
Immune responses and exploratory areas
Research also evaluates proteins associated with T cells, monocytes, macrophages, and liver immune pathways. Post-hoc analyses ask additional questions of existing data. Peripheral-nerve injury is an exploratory topic without a complete verified reference here and is not presented as an established benefit.
References
- Effects of tesamorelin on hepatic transcriptomic signatures in HIV-associated NAFLD
- Delineating tesamorelin response pathways in HIV-associated NAFLD using a targeted proteomic and transcriptomic approach
- Effect of tesamorelin in people with HIV with and without dorsocervical fat: Post hoc analysis of phase III double-blind placebo-controlled trial
- Tesamorelin for the treatment of excess abdominal fat in HIV-1-infected patients with lipodystrophy
- Reduction in Visceral Adiposity Is Associated With an Improved Metabolic Profile in HIV-Infected Patients Receiving Tesamorelin
- 1499. Tesamorelin Reduces Visceral Adipose Tissue and Liver Fat in INSTI-Treated Persons with HIV
- Tesamorelin improves fat quality independent of changes in fat quantity
- Growth Hormone Releasing Hormone Reduces Circulating Markers of Immune Activation in Parallel with Effects on Hepatic Immune Pathways in Individuals with HIV-infection and Nonalcoholic Fatty Liver Disease
Catalog of products presented for research activities. Not for human or veterinary use. This notice does not replace verification of applicable rules.